PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8930_f_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 909aa    MW: 98627.8 Da    PI: 5.8308
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8930_f_7genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.31.9e-15504542341
            TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    +k+CnCkk++Clk+YC+Cfaag +C+e C C++C+N+ e
  Neem_8930_f_7 504 CKRCNCKKTRCLKLYCDCFAAGIYCAEPCACQGCFNRPE 542
                    79**********************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.4E-16502543IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163416.093503566IPR005172CRC domain
PfamPF036383.0E-11505540IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 909 aa     Download sequence    Send to blast
MDSPETTAKT NTAVCSSFSA ATATTNASST SSPPVQESPF SNFVSNLSPI KPVKGSHGLQ  60
GLLGLNSPPL VFTSPHTNVP RETGFLKRLP CHQSPSAEMS QNDDGGKKFA DGPCALEKSG  120
SLLQDGLVID TWKENDMRSS LQVQPSTSSG CVDEYLTDPV DVDCASSGYG VNTNTLQSSV  180
SGRTDSQETL SKFDDKNDRV SKVDVAVDIF REAEDNIHGK ATRDIKTNEQ IEFNSSLDYA  240
SKKQQSENSS AQNAGSAPRG ESDCPLQLLS EPLQTLQTYN DSLENAGVIA HGPDDNAMHD  300
LEASKQQRGM SRRCLQFAEA QPKATVDGTN PSIKSNDATS ARSSPSLVES ESLDSSYVDL  360
NAASGKRQPT NLPQPTTPMF PPRYTGRSPL TVSKPSGIGL HLNSIVNALP KGGGAIVGVK  420
LASAEHEILE NKASISVSSL ISESFDDTVS LNWLPQVDHN TTPHIKRKFN SEQTDSFEEF  480
CPLSPKRKRQ TLKKSSSTVD GDGCKRCNCK KTRCLKLYCD CFAAGIYCAE PCACQGCFNR  540
PEYEDTVLET RQQIESRNPL AFAPKIVQRV AEFVVNIGLL YPLSSVSFII FFSDFLLFNL  600
AILAVFACYR MMATILPHPQ VGTKEAATAK SHSVLKSIVN AIRLMLDVQV DVDVRVVKIC  660
MARRKQQTNE EYVGNEEIMS NRAISEGTSD AKLEMVINKR DFLHAELYDP HNLTPLTPSF  720
QCLDRAKDAS KSRILSSRYV PSPESDLTIL SSYAKSPRSL KNSEGNEMLL EANKEILDVE  780
SCCQGRDYSN TDVVDQFSSR NSLAGLCDFP PVPGFPSMAV ASSGSSKATD CTNISRLQLC  840
PRSGNLSSGG SLRWRSSPIT PMTQLAVGLR LSPEDIITSS AIASGLDTKI PSDLRNILWC  900
VAISTQLIF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483326.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X1
TrEMBLA0A067FE470.0A0A067FE47_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151961015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-33Tesmin/TSO1-like CXC domain-containing protein